SCOPe 2.08: Domain d3hu5b_: 3hu5 B:

Lineage for d3hu5b_ (3hu5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (26 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [225697] (1 PDB entry)

8. Domain d3hu5b_: 3hu5 B: [211305]
   automated match to d3kl2e_

Details for d3hu5b_

PDB Entry: 3hu5, 1.5 Å

PDB Description: crystal structure of isochorismatase family protein from desulfovibrio vulgaris subsp. vulgaris str. hildenborough

PDB Compounds: (B:) isochorismatase family protein

SCOPe Domain Sequences for d3hu5b_:

Sequence; same for both SEQRES and ATOM records:

>d3hu5b_ c.33.1.0 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
nrtvalaiidmqndfvlpgapacvegamgtvpviagllakaraegwmvlhvvrahradgs
daeksrehlfleggglcvagtpgaeivaglepasgetvlvktrfsafmgtecdmllrrrg
vdtllvsgtqypncirgtavdafaldydvvvvtdacsartpgvaesnindmramgitcvp
ltalddvlar

Timeline for d3hu5b_:

• d3hu5b_ first appeared in SCOPe 2.03
  
• d3hu5b_ appears in SCOPe 2.07