SCOPe 2.08: Domain d3hsta1: 3hst A:14-374

Lineage for d3hsta1 (3hst A:14-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries)

8. Domain d3hsta1: 3hst A:14-374 [211302]
   Other proteins in same PDB: d3hsta2, d3hstc2
   automated match to d1laxa_
   complexed with edo, tar

Details for d3hsta1

PDB Entry: 3hst, 2.25 Å

PDB Description: n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein

PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3hsta1:

Sequence; same for both SEQRES and ATOM records:

>d3hsta1 c.94.1.1 (A:14-374) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahd
rfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnp
pktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdn
agakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvt
vlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalk
syeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaq
t

Timeline for d3hsta1:

• d3hsta1 first appeared in SCOPe 2.03, called d3hsta_
  
• d3hsta1 appears in SCOPe 2.07