| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein automated matches [190140] (37 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries) |
| Domain d3hsta1: 3hst A:14-374 [211302] Other proteins in same PDB: d3hsta2, d3hstc2 automated match to d1laxa_ complexed with edo, tar |
PDB Entry: 3hst (more details), 2.25 Å
SCOPe Domain Sequences for d3hsta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hsta1 c.94.1.1 (A:14-374) automated matches {Escherichia coli K-12 [TaxId: 83333]}
klviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahd
rfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnp
pktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdn
agakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvt
vlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalk
syeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaq
t
Timeline for d3hsta1: