Lineage for d3hsrb1 (3hsr B:7-142)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695094Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)
  8. 2695098Domain d3hsrb1: 3hsr B:7-142 [211299]
    Other proteins in same PDB: d3hsra2, d3hsrb2, d3hsrc2, d3hsrd2
    automated match to d2bv6a1
    complexed with act, bt6, gol

Details for d3hsrb1

PDB Entry: 3hsr (more details), 1.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in mixed disulfide form
PDB Compounds: (B:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsrb1:

Sequence, based on SEQRES records: (download)

>d3hsrb1 a.4.5.0 (B:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvsknf

Sequence, based on observed residues (ATOM records): (download)

>d3hsrb1 a.4.5.0 (B:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasdiinn
lrnfvsknf

SCOPe Domain Coordinates for d3hsrb1:

Click to download the PDB-style file with coordinates for d3hsrb1.
(The format of our PDB-style files is described here.)

Timeline for d3hsrb1: