![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries) |
![]() | Domain d3hsrb1: 3hsr B:7-142 [211299] Other proteins in same PDB: d3hsra2, d3hsrb2, d3hsrc2, d3hsrd2 automated match to d2bv6a1 complexed with act, bt6, gol |
PDB Entry: 3hsr (more details), 1.9 Å
SCOPe Domain Sequences for d3hsrb1:
Sequence, based on SEQRES records: (download)
>d3hsrb1 a.4.5.0 (B:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]} ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere asdiinnlrnfvsknf
>d3hsrb1 a.4.5.0 (B:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]} ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds gtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasdiinn lrnfvsknf
Timeline for d3hsrb1: