SCOPe 2.08: Domain d3hsra1: 3hsr A:7-142

Lineage for d3hsra1 (3hsr A:7-142)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d3hsra1: 3hsr A:7-142 [211298]
   Other proteins in same PDB: d3hsra2, d3hsrb2, d3hsrc2, d3hsrd2
   automated match to d2bv6a1
   complexed with act, bt6, gol

Details for d3hsra1

PDB Entry: 3hsr, 1.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in mixed disulfide form

PDB Compounds: (A:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsra1:

Sequence, based on SEQRES records:

>d3hsra1 a.4.5.0 (A:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvsknf

Sequence, based on observed residues (ATOM records):

>d3hsra1 a.4.5.0 (A:7-142) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtrlqislteqgkaiksplaeisvkvfnefnisereasdiinn
lrnfvsknf

Timeline for d3hsra1:

• d3hsra1 first appeared in SCOPe 2.03, called d3hsra_
  
• d3hsra1 appears in SCOPe 2.07