Lineage for d3hsea1 (3hse A:7-139)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695094Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)
  8. 2695103Domain d3hsea1: 3hse A:7-139 [211296]
    Other proteins in same PDB: d3hsea2, d3hseb2
    automated match to d2bv6a1

Details for d3hsea1

PDB Entry: 3hse (more details), 2.9 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in reduced form
PDB Compounds: (A:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hsea1:

Sequence, based on SEQRES records: (download)

>d3hsea1 a.4.5.0 (A:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvs

Sequence, based on observed residues (ATOM records): (download)

>d3hsea1 a.4.5.0 (A:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendenikklgervfldsgt
ltpllkklkdyteqgkaiksplaeisvkvfnefnisereasdiinnlrnfvs

SCOPe Domain Coordinates for d3hsea1:

Click to download the PDB-style file with coordinates for d3hsea1.
(The format of our PDB-style files is described here.)

Timeline for d3hsea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hsea2