SCOPe 2.06: Domain d3hrxa_: 3hrx A:

Lineage for d3hrxa_ (3hrx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225694] (2 PDB entries)

8. Domain d3hrxa_: 3hrx A: [211290]
   automated match to d4fzwc_

Details for d3hrxa_

PDB Entry: 3hrx, 1.85 Å

PDB Description: crystal structure of phenylacetic acid degradation protein paag

PDB Compounds: (A:) Probable enoyl-CoA hydratase

SCOPe Domain Sequences for d3hrxa_:

Sequence; same for both SEQRES and ATOM records:

>d3hrxa_ c.14.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvlkerqdgvlvltlnrpeklnaitgelldalyaalkegeedrevrallltgagrafsag
qdltefgdrkpdyeahlrrynrvvealsglekplvvavngvaagagmslalwgdlrlaav
gasfttafvriglvpdsglsfllprlvglakaqellllsprlsaeealalglvhrvvpae
klmeealslakelaqgptrayaltkkllletyrlsltealaleavlqgqagqtqdheegv
rafrekrpprfqgr

Timeline for d3hrxa_:

• d3hrxa_ first appeared in SCOPe 2.03
  
• d3hrxa_ appears in SCOPe 2.05
  
• d3hrxa_ appears in SCOPe 2.07
  
• d3hrxa_ appears in the current release, SCOPe 2.08