SCOPe 2.04: Domain d3hrmb_: 3hrm B:

Lineage for d3hrmb_ (3hrm B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d3hrmb_: 3hrm B: [211287]
   automated match to d2bv6a1

Details for d3hrmb_

PDB Entry: 3hrm, 2.3 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in sulfenic acid form

PDB Compounds: (B:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hrmb_:

Sequence, based on SEQRES records:

>d3hrmb_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
sereasdiinnlrnfvs

Sequence, based on observed residues (ATOM records):

>d3hrmb_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtreernlqislteqgkaiksplaeisvkvfnefniser
easdiinnlrnfvs

Timeline for d3hrmb_:

• d3hrmb_ first appeared in SCOPe 2.03
  
• d3hrmb_ appears in SCOPe 2.05
  
• d3hrmb_ appears in the current release, SCOPe 2.08, called d3hrmb1