Lineage for d3hrmb1 (3hrm B:7-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984013Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)
  8. 1984021Domain d3hrmb1: 3hrm B:7-139 [211287]
    Other proteins in same PDB: d3hrma2, d3hrmb2
    automated match to d2bv6a1

Details for d3hrmb1

PDB Entry: 3hrm (more details), 2.3 Å

PDB Description: crystal structure of staphylococcus aureus protein sarz in sulfenic acid form
PDB Compounds: (B:) HTH-type transcriptional regulator sarZ

SCOPe Domain Sequences for d3hrmb1:

Sequence, based on SEQRES records: (download)

>d3hrmb1 a.4.5.0 (B:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvs

Sequence, based on observed residues (ATOM records): (download)

>d3hrmb1 a.4.5.0 (B:7-139) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqlcflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreernlqislteqgkaiksplaeisvkvfnefnisereasd
iinnlrnfvs

SCOPe Domain Coordinates for d3hrmb1:

Click to download the PDB-style file with coordinates for d3hrmb1.
(The format of our PDB-style files is described here.)

Timeline for d3hrmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hrmb2