Lineage for d3hrha_ (3hrh A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869515Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
    automatically mapped to Pfam PF00756
  6. 1869536Protein automated matches [227016] (2 species)
    not a true protein
  7. 1869537Species Mycobacterium tuberculosis [TaxId:1773] [225761] (3 PDB entries)
  8. 1869540Domain d3hrha_: 3hrh A: [211284]
    automated match to d1sfra_
    complexed with gol

Details for d3hrha_

PDB Entry: 3hrh (more details), 2.3 Å

PDB Description: crystal structure of antigen 85c and glycerol
PDB Compounds: (A:) Antigen 85-C

SCOPe Domain Sequences for d3hrha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hrha_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqsglsv
impvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavglsms
ggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwgpssdpaw
krndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdtyaadg
grngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d3hrha_:

Click to download the PDB-style file with coordinates for d3hrha_.
(The format of our PDB-style files is described here.)

Timeline for d3hrha_: