SCOPe 2.08: Domain d3hrdh2: 3hrd H:83-157

Lineage for d3hrdh2 (3hrd H:83-157)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.0: automated matches [227241] (1 protein)
   not a true family

6. Protein automated matches [227007] (6 species)
   not a true protein

7. Species Eubacterium barkeri [TaxId:1528] [225696] (1 PDB entry)

8. Domain d3hrdh2: 3hrd H:83-157 [211282]
   Other proteins in same PDB: d3hrdd1, d3hrdd3, d3hrdh1
   automated match to d1rm6c1
   complexed with ca, fad, fes, mcn, mg, mos, nio, no3, se

Details for d3hrdh2

PDB Entry: 3hrd, 2.2 Å

PDB Description: Crystal structure of nicotinate dehydrogenase

PDB Compounds: (H:) Nicotinate dehydrogenase small FeS subunit

SCOPe Domain Sequences for d3hrdh2:

Sequence; same for both SEQRES and ATOM records:

>d3hrdh2 a.56.1.0 (H:83-157) automated matches {Eubacterium barkeri [TaxId: 1528]}
dgkpsllqqcfleagavqcgyctpgmiltakalldknpdptdeeitvamsgnlcrctgyi
kihaavryavercan

Timeline for d3hrdh2:

• d3hrdh2 first appeared in SCOPe 2.03
  
• d3hrdh2 appears in SCOPe 2.07