SCOPe 2.08: Domain d3hrdh1: 3hrd H:1-82

Lineage for d3hrdh1 (3hrd H:1-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Eubacterium barkeri [TaxId:1528] [225695] (1 PDB entry)

8. Domain d3hrdh1: 3hrd H:1-82 [211281]
   Other proteins in same PDB: d3hrdd2, d3hrdd3, d3hrdh2
   automated match to d1rm6c2
   complexed with ca, fad, fes, mcn, mg, mos, nio, no3, se

Details for d3hrdh1

PDB Entry: 3hrd, 2.2 Å

PDB Description: Crystal structure of nicotinate dehydrogenase

PDB Compounds: (H:) Nicotinate dehydrogenase small FeS subunit

SCOPe Domain Sequences for d3hrdh1:

Sequence; same for both SEQRES and ATOM records:

>d3hrdh1 d.15.4.0 (H:1-82) automated matches {Eubacterium barkeri [TaxId: 1528]}
mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt
tccmlagqadestiitlegvae

Timeline for d3hrdh1:

• d3hrdh1 first appeared in SCOPe 2.03
  
• d3hrdh1 appears in SCOPe 2.07