Class a: All alpha proteins [46456] (289 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
Protein automated matches [227007] (5 species) not a true protein |
Species Eubacterium barkeri [TaxId:1528] [225696] (1 PDB entry) |
Domain d3hrdd2: 3hrd D:83-157 [211280] Other proteins in same PDB: d3hrdd1, d3hrdd3, d3hrdh1 automated match to d1rm6c1 complexed with ca, fad, fes, mcn, mg, mos, nio, no3, se |
PDB Entry: 3hrd (more details), 2.2 Å
SCOPe Domain Sequences for d3hrdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrdd2 a.56.1.0 (D:83-157) automated matches {Eubacterium barkeri [TaxId: 1528]} dgkpsllqqcfleagavqcgyctpgmiltakalldknpdptdeeitvamsgnlcrctgyi kihaavryavercan
Timeline for d3hrdd2: