![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries) |
![]() | Domain d1yuhl2: 1yuh L:110-212 [21128] Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl1 |
PDB Entry: 1yuh (more details), 3 Å
SCOP Domain Sequences for d1yuhl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuhl2 b.1.1.2 (L:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)} gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk qsnnkymassyltlsarawerhasyscqvtheghtvekslsra
Timeline for d1yuhl2: