Lineage for d3hrdd1 (3hrd D:1-82)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934249Species Eubacterium barkeri [TaxId:1528] [225695] (1 PDB entry)
  8. 2934250Domain d3hrdd1: 3hrd D:1-82 [211279]
    Other proteins in same PDB: d3hrdd2, d3hrdd3, d3hrdh2
    automated match to d1rm6c2
    complexed with ca, fad, fes, mcn, mg, mos, nio, no3, se

Details for d3hrdd1

PDB Entry: 3hrd (more details), 2.2 Å

PDB Description: Crystal structure of nicotinate dehydrogenase
PDB Compounds: (D:) Nicotinate dehydrogenase small FeS subunit

SCOPe Domain Sequences for d3hrdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hrdd1 d.15.4.0 (D:1-82) automated matches {Eubacterium barkeri [TaxId: 1528]}
mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt
tccmlagqadestiitlegvae

SCOPe Domain Coordinates for d3hrdd1:

Click to download the PDB-style file with coordinates for d3hrdd1.
(The format of our PDB-style files is described here.)

Timeline for d3hrdd1: