![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Eubacterium barkeri [TaxId:1528] [225695] (1 PDB entry) |
![]() | Domain d3hrdd1: 3hrd D:1-82 [211279] Other proteins in same PDB: d3hrdd2, d3hrdd3, d3hrdh2 automated match to d1rm6c2 complexed with ca, fad, fes, mcn, mg, mos, nio, no3, se |
PDB Entry: 3hrd (more details), 2.2 Å
SCOPe Domain Sequences for d3hrdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrdd1 d.15.4.0 (D:1-82) automated matches {Eubacterium barkeri [TaxId: 1528]} mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt tccmlagqadestiitlegvae
Timeline for d3hrdd1: