Lineage for d1vgeh2 (1vge H:123-225)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365043Domain d1vgeh2: 1vge H:123-225 [21127]
    Other proteins in same PDB: d1vgeh1, d1vgel1, d1vgel2
    part of humanized Fab TR1.9

Details for d1vgeh2

PDB Entry: 1vge (more details), 2 Å

PDB Description: tr1.9 fab fragment of a human igg1 kappa autoantibody
PDB Compounds: (H:)

SCOP Domain Sequences for d1vgeh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgeh2 b.1.1.2 (H:123-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1vgeh2:

Click to download the PDB-style file with coordinates for d1vgeh2.
(The format of our PDB-style files is described here.)

Timeline for d1vgeh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgeh1