| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d1vgeh2: 1vge H:123-225 [21127] Other proteins in same PDB: d1vgeh1, d1vgel1, d1vgel2 part of humanized Fab TR1.9 |
PDB Entry: 1vge (more details), 2 Å
SCOP Domain Sequences for d1vgeh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgeh2 b.1.1.2 (H:123-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1vgeh2: