![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Fab TR1.9 (mouse/human), kappa L chain [49029] (1 PDB entry) |
![]() | Domain d1vgeh2: 1vge H:123-225 [21127] Other proteins in same PDB: d1vgeh1, d1vgel1 |
PDB Entry: 1vge (more details), 2 Å
SCOP Domain Sequences for d1vgeh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgeh2 b.1.1.2 (H:123-225) Immunoglobulin (constant domains of L and H chains) {Fab TR1.9 (mouse/human), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1vgeh2: