Lineage for d3hqpj3 (3hqp J:358-498)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371048Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1371049Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1371050Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1371138Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 1371154Domain d3hqpj3: 3hqp J:358-498 [211259]
    Other proteins in same PDB: d3hqpa1, d3hqpa2, d3hqpb1, d3hqpb2, d3hqpc1, d3hqpc2, d3hqpd1, d3hqpd2, d3hqpe1, d3hqpe2, d3hqpf1, d3hqpf2, d3hqpg1, d3hqpg2, d3hqph1, d3hqph2, d3hqpi1, d3hqpi2, d3hqpj1, d3hqpj2, d3hqpk1, d3hqpk2, d3hqpl1, d3hqpl2, d3hqpm1, d3hqpm2, d3hqpn1, d3hqpn2, d3hqpo1, d3hqpo2, d3hqpp1, d3hqpp2
    automated match to d1pkla3
    complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpj3

PDB Entry: 3hqp (more details), 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate
PDB Compounds: (J:) pyruvate kinase

SCOPe Domain Sequences for d3hqpj3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqpj3 c.49.1.1 (J:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

SCOPe Domain Coordinates for d3hqpj3:

Click to download the PDB-style file with coordinates for d3hqpj3.
(The format of our PDB-style files is described here.)

Timeline for d3hqpj3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqpa1, d3hqpa2, d3hqpa3, d3hqpb1, d3hqpb2, d3hqpb3, d3hqpc1, d3hqpc2, d3hqpc3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpe1, d3hqpe2, d3hqpe3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3