SCOPe 2.08: Domain d3hqpg3: 3hqp G:358-498

Lineage for d3hqpg3 (3hqp G:358-498)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
   automatically mapped to Pfam PF02887

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)

8. Domain d3hqpg3: 3hqp G:358-498 [211250]
   Other proteins in same PDB: d3hqpa1, d3hqpa2, d3hqpb1, d3hqpb2, d3hqpc1, d3hqpc2, d3hqpd1, d3hqpd2, d3hqpe1, d3hqpe2, d3hqpf1, d3hqpf2, d3hqpg1, d3hqpg2, d3hqph1, d3hqph2, d3hqpi1, d3hqpi2, d3hqpj1, d3hqpj2, d3hqpk1, d3hqpk2, d3hqpl1, d3hqpl2, d3hqpm1, d3hqpm2, d3hqpn1, d3hqpn2, d3hqpo1, d3hqpo2, d3hqpp1, d3hqpp2
   automated match to d1pkla3
   complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpg3

PDB Entry: 3hqp, 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate

PDB Compounds: (G:) pyruvate kinase

SCOPe Domain Sequences for d3hqpg3:

Sequence; same for both SEQRES and ATOM records:

>d3hqpg3 c.49.1.1 (G:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Timeline for d3hqpg3:

• d3hqpg3 first appeared in SCOPe 2.03
  
• d3hqpg3 appears in SCOPe 2.07