SCOPe 2.08: Domain d3hqpg2: 3hqp G:88-186

Lineage for d3hqpg2 (3hqp G:88-186)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
   this domain interrupts beta/alpha-barrel domain
   C-terminal domain is alpha/beta

6. Protein Pyruvate kinase (PK) [50802] (6 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)

8. Domain d3hqpg2: 3hqp G:88-186 [211249]
   Other proteins in same PDB: d3hqpa1, d3hqpa3, d3hqpb1, d3hqpb3, d3hqpc1, d3hqpc3, d3hqpd1, d3hqpd3, d3hqpe1, d3hqpe3, d3hqpf1, d3hqpf3, d3hqpg1, d3hqpg3, d3hqph1, d3hqph3, d3hqpi1, d3hqpi3, d3hqpj1, d3hqpj3, d3hqpk1, d3hqpk3, d3hqpl1, d3hqpl3, d3hqpm1, d3hqpm3, d3hqpn1, d3hqpn3, d3hqpo1, d3hqpo3, d3hqpp1, d3hqpp3
   automated match to d1pkla1
   complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpg2

PDB Entry: 3hqp, 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate

PDB Compounds: (G:) pyruvate kinase

SCOPe Domain Sequences for d3hqpg2:

Sequence; same for both SEQRES and ATOM records:

>d3hqpg2 b.58.1.1 (G:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

Timeline for d3hqpg2:

• d3hqpg2 first appeared in SCOPe 2.03
  
• d3hqpg2 appears in SCOPe 2.07