Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries) |
Domain d3hqpc3: 3hqp C:358-498 [211238] Other proteins in same PDB: d3hqpa1, d3hqpa2, d3hqpb1, d3hqpb2, d3hqpc1, d3hqpc2, d3hqpd1, d3hqpd2, d3hqpe1, d3hqpe2, d3hqpf1, d3hqpf2, d3hqpg1, d3hqpg2, d3hqph1, d3hqph2, d3hqpi1, d3hqpi2, d3hqpj1, d3hqpj2, d3hqpk1, d3hqpk2, d3hqpl1, d3hqpl2, d3hqpm1, d3hqpm2, d3hqpn1, d3hqpn2, d3hqpo1, d3hqpo2, d3hqpp1, d3hqpp2 automated match to d1pkla3 complexed with atp, fdp, gol, k, mg, oxl |
PDB Entry: 3hqp (more details), 2.3 Å
SCOPe Domain Sequences for d3hqpc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqpc3 c.49.1.1 (C:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]} neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv vihadhkvkgyanqtrillve
Timeline for d3hqpc3:
View in 3D Domains from other chains: (mouse over for more information) d3hqpa1, d3hqpa2, d3hqpa3, d3hqpb1, d3hqpb2, d3hqpb3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpe1, d3hqpe2, d3hqpe3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpj1, d3hqpj2, d3hqpj3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3 |