Class b: All beta proteins [48724] (174 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
Protein Pyruvate kinase (PK) [50802] (6 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries) |
Domain d3hqpc2: 3hqp C:88-186 [211237] Other proteins in same PDB: d3hqpa1, d3hqpa3, d3hqpb1, d3hqpb3, d3hqpc1, d3hqpc3, d3hqpd1, d3hqpd3, d3hqpe1, d3hqpe3, d3hqpf1, d3hqpf3, d3hqpg1, d3hqpg3, d3hqph1, d3hqph3, d3hqpi1, d3hqpi3, d3hqpj1, d3hqpj3, d3hqpk1, d3hqpk3, d3hqpl1, d3hqpl3, d3hqpm1, d3hqpm3, d3hqpn1, d3hqpn3, d3hqpo1, d3hqpo3, d3hqpp1, d3hqpp3 automated match to d1pkla1 complexed with atp, fdp, gol, k, mg, oxl |
PDB Entry: 3hqp (more details), 2.3 Å
SCOPe Domain Sequences for d3hqpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqpc2 b.58.1.1 (C:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl
Timeline for d3hqpc2:
View in 3D Domains from other chains: (mouse over for more information) d3hqpa1, d3hqpa2, d3hqpa3, d3hqpb1, d3hqpb2, d3hqpb3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpe1, d3hqpe2, d3hqpe3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpj1, d3hqpj2, d3hqpj3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3 |