Lineage for d3hqpa3 (3hqp A:358-498)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488766Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2488767Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2488768Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2488871Species Trypanosome (Leishmania mexicana) [TaxId:5665] [52940] (11 PDB entries)
  8. 2488876Domain d3hqpa3: 3hqp A:358-498 [211232]
    Other proteins in same PDB: d3hqpa1, d3hqpa2, d3hqpb1, d3hqpb2, d3hqpc1, d3hqpc2, d3hqpd1, d3hqpd2, d3hqpe1, d3hqpe2, d3hqpf1, d3hqpf2, d3hqpg1, d3hqpg2, d3hqph1, d3hqph2, d3hqpi1, d3hqpi2, d3hqpj1, d3hqpj2, d3hqpk1, d3hqpk2, d3hqpl1, d3hqpl2, d3hqpm1, d3hqpm2, d3hqpn1, d3hqpn2, d3hqpo1, d3hqpo2, d3hqpp1, d3hqpp2
    automated match to d1pkla3
    complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpa3

PDB Entry: 3hqp (more details), 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3hqpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqpa3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

SCOPe Domain Coordinates for d3hqpa3:

Click to download the PDB-style file with coordinates for d3hqpa3.
(The format of our PDB-style files is described here.)

Timeline for d3hqpa3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqpb1, d3hqpb2, d3hqpb3, d3hqpc1, d3hqpc2, d3hqpc3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpe1, d3hqpe2, d3hqpe3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpj1, d3hqpj2, d3hqpj3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3