Lineage for d3hqpa2 (3hqp A:88-186)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551526Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 1551527Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 1551528Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 1551529Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 1551617Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)
  8. 1551624Domain d3hqpa2: 3hqp A:88-186 [211231]
    Other proteins in same PDB: d3hqpa1, d3hqpa3, d3hqpb1, d3hqpb3, d3hqpc1, d3hqpc3, d3hqpd1, d3hqpd3, d3hqpe1, d3hqpe3, d3hqpf1, d3hqpf3, d3hqpg1, d3hqpg3, d3hqph1, d3hqph3, d3hqpi1, d3hqpi3, d3hqpj1, d3hqpj3, d3hqpk1, d3hqpk3, d3hqpl1, d3hqpl3, d3hqpm1, d3hqpm3, d3hqpn1, d3hqpn3, d3hqpo1, d3hqpo3, d3hqpp1, d3hqpp3
    automated match to d1pkla1
    complexed with atp, fdp, gol, k, mg, oxl

Details for d3hqpa2

PDB Entry: 3hqp (more details), 2.3 Å

PDB Description: crystal structure of leishmania mexicana pyruvate kinase (lmpyk) in complex with atp, oxalate and fructose 2,6 bisphosphate
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d3hqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqpa2 b.58.1.1 (A:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOPe Domain Coordinates for d3hqpa2:

Click to download the PDB-style file with coordinates for d3hqpa2.
(The format of our PDB-style files is described here.)

Timeline for d3hqpa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hqpb1, d3hqpb2, d3hqpb3, d3hqpc1, d3hqpc2, d3hqpc3, d3hqpd1, d3hqpd2, d3hqpd3, d3hqpe1, d3hqpe2, d3hqpe3, d3hqpf1, d3hqpf2, d3hqpf3, d3hqpg1, d3hqpg2, d3hqpg3, d3hqph1, d3hqph2, d3hqph3, d3hqpi1, d3hqpi2, d3hqpi3, d3hqpj1, d3hqpj2, d3hqpj3, d3hqpk1, d3hqpk2, d3hqpk3, d3hqpl1, d3hqpl2, d3hqpl3, d3hqpm1, d3hqpm2, d3hqpm3, d3hqpn1, d3hqpn2, d3hqpn3, d3hqpo1, d3hqpo2, d3hqpo3, d3hqpp1, d3hqpp2, d3hqpp3