SCOP 1.55: Domain d1ngph2: 1ngp H:121-220

Lineage for d1ngph2 (1ngp H:121-220)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab N1G9 (mouse/human), kappa L chain [49028] (2 PDB entries)

8. Domain d1ngph2: 1ngp H:121-220 [21123]
   Other proteins in same PDB: d1ngph1, d1ngpl1

Details for d1ngph2

PDB Entry: 1ngp, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngph2:

Sequence, based on SEQRES records:

>d1ngph2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1ngph2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Timeline for d1ngph2:

• d1ngph2 appears in SCOP 1.57
  
• d1ngph2 appears in the current release, SCOPe 2.08