Lineage for d3hqnd1 (3hqn D:1-87,D:187-357)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574300Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1574301Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 1574302Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 1574390Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 1574392Domain d3hqnd1: 3hqn D:1-87,D:187-357 [211227]
    Other proteins in same PDB: d3hqna2, d3hqna3, d3hqnd2, d3hqnd3
    automated match to d1pkla2
    complexed with gol, k, so4

Details for d3hqnd1

PDB Entry: 3hqn (more details), 2 Å

PDB Description: Apo crystal structure of Leishmania mexicana(LmPYK)pyruvate kinase
PDB Compounds: (D:) pyruvate kinase

SCOPe Domain Sequences for d3hqnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqnd1 c.1.12.1 (D:1-87,D:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOPe Domain Coordinates for d3hqnd1:

Click to download the PDB-style file with coordinates for d3hqnd1.
(The format of our PDB-style files is described here.)

Timeline for d3hqnd1: