Lineage for d3hq9a2 (3hq9 A:189-345)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720291Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1720292Protein automated matches [190453] (18 species)
    not a true protein
  7. 1720318Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 1720321Domain d3hq9a2: 3hq9 A:189-345 [211221]
    automated match to d1nmla2
    complexed with bu3, ca, hem, imd, oxl

Details for d3hq9a2

PDB Entry: 3hq9 (more details), 1.52 Å

PDB Description: ccpa from g. sulfurreducens, s134p variant
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq9a2:

Sequence, based on SEQRES records: (download)

>d3hq9a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp
lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd
deseaiaaflgsltgkqpkvvypimpastdatprprl

Sequence, based on observed residues (ATOM records): (download)

>d3hq9a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvegrfavtnt
akdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsddeseaiaaflgs
ltgkqpkvvypimpastdatprprl

SCOPe Domain Coordinates for d3hq9a2:

Click to download the PDB-style file with coordinates for d3hq9a2.
(The format of our PDB-style files is described here.)

Timeline for d3hq9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hq9a1