SCOPe 2.06: Domain d3hq9a1: 3hq9 A:22-188

Lineage for d3hq9a1 (3hq9 A:22-188)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (22 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)

8. Domain d3hq9a1: 3hq9 A:22-188 [211220]
   automated match to d1nmla1
   complexed with bu3, ca, hem, imd, oxl

Details for d3hq9a1

PDB Entry: 3hq9, 1.52 Å

PDB Description: ccpa from g. sulfurreducens, s134p variant

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq9a1:

Sequence; same for both SEQRES and ATOM records:

>d3hq9a1 a.3.1.0 (A:22-188) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapvemnntp
dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitp

Timeline for d3hq9a1:

• d3hq9a1 first appeared in SCOPe 2.03
  
• d3hq9a1 appears in SCOPe 2.05
  
• d3hq9a1 appears in SCOPe 2.07
  
• d3hq9a1 appears in the current release, SCOPe 2.08