SCOP 1.69: Domain d1ngpl2: 1ngp L:110-211

Lineage for d1ngpl2 (1ngp L:110-211)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)

8. Domain d1ngpl2: 1ngp L:110-211 [21122]
   Other proteins in same PDB: d1ngph1, d1ngph2, d1ngpl1
   part of Fab N1G9

Details for d1ngpl2

PDB Entry: 1ngp, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngpl2:

Sequence; same for both SEQRES and ATOM records:

>d1ngpl2 b.1.1.2 (L:110-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d1ngpl2:

• d1ngpl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ngpl2 appears in SCOP 1.67
  
• d1ngpl2 appears in SCOP 1.71
  
• d1ngpl2 appears in the current release, SCOPe 2.08