Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries) |
Domain d1ngpl2: 1ngp L:110-211 [21122] Other proteins in same PDB: d1ngph1, d1ngph2, d1ngpl1 part of Fab N1G9 |
PDB Entry: 1ngp (more details), 2.4 Å
SCOP Domain Sequences for d1ngpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngpl2 b.1.1.2 (L:110-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)} gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk qsnnkymassyltltarawerhssyscqvtheghtvekslsr
Timeline for d1ngpl2: