Lineage for d3hq8b2 (3hq8 B:189-345)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305097Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 2305113Domain d3hq8b2: 3hq8 B:189-345 [211219]
    automated match to d1nmla2
    complexed with ca, hem, imd

Details for d3hq8b2

PDB Entry: 3hq8 (more details), 2.4 Å

PDB Description: ccpa from g. sulfurreducens s134p/v135k variant
PDB Compounds: (B:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq8b2:

Sequence, based on SEQRES records: (download)

>d3hq8b2 a.3.1.0 (B:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp
lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd
deseaiaaflgsltgkqpkvvypimpastdatprprl

Sequence, based on observed residues (ATOM records): (download)

>d3hq8b2 a.3.1.0 (B:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekgrfavtn
takdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsddeseaiaaflg
sltgkqpkvvypimpastdatprprl

SCOPe Domain Coordinates for d3hq8b2:

Click to download the PDB-style file with coordinates for d3hq8b2.
(The format of our PDB-style files is described here.)

Timeline for d3hq8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hq8b1