SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3hq8a1 (3hq8 A:22-188)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (21 species)
    not a true protein
  7. 1981053Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)
  8. 1981066Domain d3hq8a1: 3hq8 A:22-188 [211216]
    automated match to d1nmla1
    complexed with ca, hem, imd

Details for d3hq8a1

PDB Entry: 3hq8 (more details), 2.4 Å

PDB Description: CcpA from G. sulfurreducens S134P/V135K variant
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq8a1 a.3.1.0 (A:22-188) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
adelqqraqglfkpvpakaptlkgnpaspvkvelgkmlyfdprlsashliscntchnvgl
gggdlqatstghgwqkgprnaptvlnsvfntaqfwdgrakdlaeqakgpvqapkemnntp
dqvvktlnsipdyvalfkkafpgekdpvtfdnmakaievfeatlitp

SCOPe Domain Coordinates for d3hq8a1:

Click to download the PDB-style file with coordinates for d3hq8a1.
(The format of our PDB-style files is described here.)

Timeline for d3hq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hq8a2