SCOPe 2.03: Domain d3hq7a2: 3hq7 A:189-345

Lineage for d3hq7a2 (3hq7 A:189-345)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (16 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)

8. Domain d3hq7a2: 3hq7 A:189-345 [211215]
   automated match to d1nmla2
   complexed with ca, hem

Details for d3hq7a2

PDB Entry: 3hq7, 2.31 Å

PDB Description: ccpa from g. sulfurreducens, g94k/k97q/r100i variant

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3hq7a2:

Sequence, based on SEQRES records:

>d3hq7a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpaenilp
lgdkgrfavtntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsd
deseaiaaflgsltgkqpkvvypimpastdatprprl

Sequence, based on observed residues (ATOM records):

>d3hq7a2 a.3.1.0 (A:189-345) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
dspfdqylkgkkkaldgkqtaglklfldkgcvachgglnlggtgyfpfgvvekpkgrfav
tntakdeyvfrapslrnvaitypyfhsgvvwslkeavavmgsaqfgiklsddeseaiaaf
lgsltgkqpkvvypimpastdatprprl

Timeline for d3hq7a2:

• d3hq7a2 is new in SCOPe 2.03-stable
  
• d3hq7a2 appears in SCOPe 2.04
  
• d3hq7a2 appears in the current release, SCOPe 2.08