Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (20 species) not a true protein |
Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries) |
Domain d3hpvd2: 3hpv D:147-289 [211193] automated match to d1mpya2 complexed with fe2 |
PDB Entry: 3hpv (more details), 2.3 Å
SCOPe Domain Sequences for d3hpvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hpvd2 d.32.1.0 (D:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]} iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf etfmggyhpypdyeplswtydnf
Timeline for d3hpvd2: