SCOPe 2.06: Domain d3hpvd2: 3hpv D:147-289

Lineage for d3hpvd2 (3hpv D:147-289)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (20 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)

8. Domain d3hpvd2: 3hpv D:147-289 [211193]
   automated match to d1mpya2
   complexed with fe2

Details for d3hpvd2

PDB Entry: 3hpv, 2.3 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. kl28

PDB Compounds: (D:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hpvd2:

Sequence; same for both SEQRES and ATOM records:

>d3hpvd2 d.32.1.0 (D:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}
iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv
eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf
etfmggyhpypdyeplswtydnf

Timeline for d3hpvd2:

• d3hpvd2 first appeared in SCOPe 2.03
  
• d3hpvd2 appears in SCOPe 2.05
  
• d3hpvd2 appears in SCOPe 2.07
  
• d3hpvd2 appears in the current release, SCOPe 2.08