Lineage for d3hpvc2 (3hpv C:147-289)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942999Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)
  8. 2943021Domain d3hpvc2: 3hpv C:147-289 [211191]
    automated match to d1mpya2
    complexed with fe2

Details for d3hpvc2

PDB Entry: 3hpv (more details), 2.3 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. kl28
PDB Compounds: (C:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hpvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpvc2 d.32.1.0 (C:147-289) automated matches {Pseudomonas sp. [TaxId: 237609]}
iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv
eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf
etfmggyhpypdyeplswtydnf

SCOPe Domain Coordinates for d3hpvc2:

Click to download the PDB-style file with coordinates for d3hpvc2.
(The format of our PDB-style files is described here.)

Timeline for d3hpvc2: