SCOPe 2.08: Domain d3hpva1: 3hpv A:2-146

Lineage for d3hpva1 (3hpv A:2-146)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)

8. Domain d3hpva1: 3hpv A:2-146 [211186]
   automated match to d1mpya1
   complexed with fe2

Details for d3hpva1

PDB Entry: 3hpv, 2.3 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. kl28

PDB Compounds: (A:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hpva1:

Sequence; same for both SEQRES and ATOM records:

>d3hpva1 d.32.1.0 (A:2-146) automated matches {Pseudomonas sp. [TaxId: 237609]}
amtgvlrpghaqvrvlnleegihfyrnvlglvetgrddqgrvyfkcwderdhscyiirea
dtagidffgfkvldkatlekldadlqaygltttripagemletgervrfelpsghliely
aektcvgngisevnpapwnaqrehg

Timeline for d3hpva1:

• d3hpva1 first appeared in SCOPe 2.03
  
• d3hpva1 appears in SCOPe 2.07