SCOPe 2.03: Domain d3hpqb2: 3hpq B:122-156

Lineage for d3hpqb2 (3hpq B:122-156)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Escherichia coli [TaxId:562] [57778] (7 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d3hpqb2: 3hpq B:122-156 [211185]
   Other proteins in same PDB: d3hpqa1, d3hpqb1
   automated match to d1akea2
   complexed with ap5

Details for d3hpqb2

PDB Entry: 3hpq, 2 Å

PDB Description: Crystal structure of wild-type adenylate kinase from E. coli, in complex with Ap5A

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d3hpqb2:

Sequence; same for both SEQRES and ATOM records:

>d3hpqb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d3hpqb2:

• d3hpqb2 is new in SCOPe 2.03-stable
  
• d3hpqb2 appears in SCOPe 2.04
  
• d3hpqb2 appears in the current release, SCOPe 2.08