Lineage for d3hpqa2 (3hpq A:122-156)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2262928Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2262929Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2262930Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2262954Species Escherichia coli [TaxId:562] [57778] (8 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 2262959Domain d3hpqa2: 3hpq A:122-156 [211183]
    Other proteins in same PDB: d3hpqa1, d3hpqb1
    automated match to d1akea2
    complexed with ap5

Details for d3hpqa2

PDB Entry: 3hpq (more details), 2 Å

PDB Description: Crystal structure of wild-type adenylate kinase from E. coli, in complex with Ap5A
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3hpqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hpqa2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOPe Domain Coordinates for d3hpqa2:

Click to download the PDB-style file with coordinates for d3hpqa2.
(The format of our PDB-style files is described here.)

Timeline for d3hpqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hpqa1