Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) automatically mapped to Pfam PF05191 |
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species) |
Species Escherichia coli [TaxId:562] [57778] (8 PDB entries) contains a rudiment form of the domain that lacks zn-binding site |
Domain d3hpqa2: 3hpq A:122-156 [211183] Other proteins in same PDB: d3hpqa1, d3hpqb1 automated match to d1akea2 complexed with ap5 |
PDB Entry: 3hpq (more details), 2 Å
SCOPe Domain Sequences for d3hpqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hpqa2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d3hpqa2: