SCOPe 2.06: Domain d3hpqa1: 3hpq A:1-121,A:157-214

Lineage for d3hpqa1 (3hpq A:1-121,A:157-214)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Escherichia coli [TaxId:562] [52560] (8 PDB entries)
   contains a rudiment "zinc-finger" subdomain, residue 122-156

8. Domain d3hpqa1: 3hpq A:1-121,A:157-214 [211182]
   Other proteins in same PDB: d3hpqa2, d3hpqb2
   automated match to d1akea1
   complexed with ap5

Details for d3hpqa1

PDB Entry: 3hpq, 2 Å

PDB Description: Crystal structure of wild-type adenylate kinase from E. coli, in complex with Ap5A

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d3hpqa1:

Sequence; same for both SEQRES and ATOM records:

>d3hpqa1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d3hpqa1:

• d3hpqa1 first appeared in SCOPe 2.03
  
• d3hpqa1 appears in SCOPe 2.05
  
• d3hpqa1 appears in SCOPe 2.07
  
• d3hpqa1 appears in the current release, SCOPe 2.08