| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
| Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
| Protein automated matches [226856] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
| Domain d3hopa2: 3hop A:163-269 [211175] automated match to d1sh5a2 complexed with po4 |
PDB Entry: 3hop (more details), 2.3 Å
SCOPe Domain Sequences for d3hopa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hopa2 a.40.1.0 (A:163-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkqtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpv
tnareamqqaddwlgipqvitpeeivdpnvdehsvmtylsqfpkakl
Timeline for d3hopa2: