SCOPe 2.08: Domain d3hopa1: 3hop A:37-151

Lineage for d3hopa1 (3hop A:37-151)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d3hopa1: 3hop A:37-151 [211174]
   automated match to d1sh5a1
   complexed with po4

Details for d3hopa1

PDB Entry: 3hop, 2.3 Å

PDB Description: structure of the actin-binding domain of human filamin a

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d3hopa1:

Sequence; same for both SEQRES and ATOM records:

>d3hopa1 a.40.1.0 (A:37-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edapwkkiqqntftrwcnehlkcvskrianlqtdlsdglrliallevlsqkkmhrkhnqr
ptfrqmqlenvsvalefldresiklvsidskaivdgnlklilgliwtlilhysis

Timeline for d3hopa1:

• d3hopa1 first appeared in SCOPe 2.03
  
• d3hopa1 appears in SCOPe 2.07