SCOP 1.71: Domain d1aj7h2: 1aj7 H:115-216

Lineage for d1aj7h2 (1aj7 H:115-216)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1aj7h2: 1aj7 H:115-216 [21117]
   Other proteins in same PDB: d1aj7h1, d1aj7l1, d1aj7l2
   part of humanized Fab 48G7
   complexed with npe

Details for d1aj7h2

PDB Entry: 1aj7, 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d1aj7h2:

Sequence; same for both SEQRES and ATOM records:

>d1aj7h2 b.1.1.2 (H:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1aj7h2:

• d1aj7h2 first appeared (with stable ids) in SCOP 1.55
  
• d1aj7h2 appears in SCOP 1.69
  
• d1aj7h2 appears in SCOP 1.73
  
• d1aj7h2 appears in the current release, SCOPe 2.08