SCOPe 2.03: Domain d3ho7b_: 3ho7 B:

Lineage for d3ho7b_ (3ho7 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries)

8. Domain d3ho7b_: 3ho7 B: [211164]
   automated match to d1i6aa_

Details for d3ho7b_

PDB Entry: 3ho7, 1.58 Å

PDB Description: Crystal structure of OxyR from Porphyromonas gingivalis

PDB Compounds: (B:) OxyR

SCOPe Domain Sequences for d3ho7b_:

Sequence; same for both SEQRES and ATOM records:

>d3ho7b_ c.94.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghcfrdqlvrfcq
mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
rlavrqdysrrklreqligllrsavpsdmhklqtgqhlah

Timeline for d3ho7b_:

• d3ho7b_ is new in SCOPe 2.03-stable
  
• d3ho7b_ appears in SCOPe 2.04
  
• d3ho7b_ appears in the current release, SCOPe 2.08, called d3ho7b1