| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (57 species) not a true protein |
| Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries) |
| Domain d3ho7a_: 3ho7 A: [211163] automated match to d1i6aa_ |
PDB Entry: 3ho7 (more details), 1.58 Å
SCOPe Domain Sequences for d3ho7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ho7a_ c.94.1.0 (A:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
tgrlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiask
aetegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghcfrdqlvrfcq
mkglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrev
rlavrqdysrrklreqligllrsavpsdmhklqtgqhlah
Timeline for d3ho7a_: