SCOPe 2.08: Domain d3hnza2: 3hnz A:252-412

Lineage for d3hnza2 (3hnz A:252-412)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225630] (7 PDB entries)

8. Domain d3hnza2: 3hnz A:252-412 [211160]
   automated match to d1e5ma2
   complexed with pmn

Details for d3hnza2

PDB Entry: 3hnz, 2.75 Å

PDB Description: structure of e. coli fabf(c163a) in complex with platensimycin

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d3hnza2:

Sequence; same for both SEQRES and ATOM records:

>d3hnza2 c.95.1.0 (A:252-412) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvnahgtstpagd
kaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqavpptinldnp
degcdldfvphearqvsgmeytlcnsfgfggtngslifkki

Timeline for d3hnza2:

• d3hnza2 first appeared in SCOPe 2.03
  
• d3hnza2 appears in SCOPe 2.07