Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab 48G7 (mouse/human), kappa L chain [49027] (4 PDB entries) |
Domain d1gafl2: 1gaf L:110-214 [21114] Other proteins in same PDB: d1gafh1, d1gafl1 |
PDB Entry: 1gaf (more details), 1.95 Å
SCOP Domain Sequences for d1gafl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gafl2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain} vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk dstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1gafl2: