Lineage for d3hmkb_ (3hmk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140163Species Norway rat (Rattus norvegicus) [TaxId:10116] [196477] (2 PDB entries)
  8. 2140165Domain d3hmkb_: 3hmk B: [211131]
    automated match to d3l6cb_
    complexed with mn, plp

Details for d3hmkb_

PDB Entry: 3hmk (more details), 2.1 Å

PDB Description: Crystal Structure of Serine Racemase
PDB Compounds: (B:) Serine racemase

SCOPe Domain Sequences for d3hmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmkb_ c.79.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqydisfadvekahlniqdsvhltpvltssilnqiagrnlffkcelfqktgsfkirgaln
airglipdtlegkpkavvthssgnhgqaltyaaklegipayivvpqtapnckklaiqayg
asivysepsdesrenvaqriiqetegilvhpnqepaviagqgtialevlnqvplvdalvv
pvggggmvagiaitiktlkpsvkvyaaepsnaddcyqsklkgeltpnlhppetiadgvks
siglntwpiirdlvddvftvtedeikyatqlvwermkllieptagvglaavlsqhfqtvs
pevknicivlsggnvdltslsw

SCOPe Domain Coordinates for d3hmkb_:

Click to download the PDB-style file with coordinates for d3hmkb_.
(The format of our PDB-style files is described here.)

Timeline for d3hmkb_: