SCOPe 2.05: Domain d3hmka_: 3hmk A:

Lineage for d3hmka_ (3hmk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (23 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [196477] (2 PDB entries)

8. Domain d3hmka_: 3hmk A: [211130]
   automated match to d3l6cb_
   complexed with mn, plp

Details for d3hmka_

PDB Entry: 3hmk, 2.1 Å

PDB Description: crystal structure of serine racemase

PDB Compounds: (A:) Serine racemase

SCOPe Domain Sequences for d3hmka_:

Sequence; same for both SEQRES and ATOM records:

>d3hmka_ c.79.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aqydisfadvekahlniqdsvhltpvltssilnqiagrnlffkcelfqktgsfkirgaln
airglipdtlegkpkavvthssgnhgqaltyaaklegipayivvpqtapnckklaiqayg
asivysepsdesrenvaqriiqetegilvhpnqepaviagqgtialevlnqvplvdalvv
pvggggmvagiaitiktlkpsvkvyaaepsnaddcyqsklkgeltpnlhppetiadgvks
siglntwpiirdlvddvftvtedeikyatqlvwermkllieptagvglaavlsqhfqtvs
pevknicivlsggnvdltsls

Timeline for d3hmka_:

• d3hmka_ first appeared in SCOPe 2.03
  
• d3hmka_ appears in SCOPe 2.04
  
• d3hmka_ appears in SCOPe 2.06
  
• d3hmka_ appears in the current release, SCOPe 2.08