SCOPe 2.04: Domain d3hl5a_: 3hl5 A:

Lineage for d3hl5a_ (3hl5 A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (25 PDB entries)

8. Domain d3hl5a_: 3hl5 A: [211119]
   automated match to d3cm2a_
   complexed with 9jz, zn

Details for d3hl5a_

PDB Entry: 3hl5, 1.8 Å

PDB Description: Crystal structure of XIAP BIR3 with CS3

PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3hl5a_:

Sequence; same for both SEQRES and ATOM records:

>d3hl5a_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
sedpweqhakwypgckylleqkgqeyinnihlth

Timeline for d3hl5a_:

• d3hl5a_ first appeared in SCOPe 2.03
  
• d3hl5a_ appears in SCOPe 2.05
  
• d3hl5a_ appears in the current release, SCOPe 2.08, called d3hl5a1