SCOPe 2.06: Domain d3hksa2: 3hks A:85-159

Lineage for d3hksa2 (3hks A:85-159)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225760] (1 PDB entry)

8. Domain d3hksa2: 3hks A:85-159 [211116]
   Other proteins in same PDB: d3hksa1, d3hksb1
   automated match to d1xtda2
   complexed with edo

Details for d3hksa2

PDB Entry: 3hks, 2.3 Å

PDB Description: Crystal structure of eukaryotic translation initiation factor eIF-5A2 from Arabidopsis thaliana

PDB Compounds: (A:) Eukaryotic translation initiation factor 5A-2

SCOPe Domain Sequences for d3hksa2:

Sequence; same for both SEQRES and ATOM records:

>d3hksa2 b.40.4.0 (A:85-159) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vnrvdyqliditedgfvslltdsggtkddlklptddgltaqmrlgfdegkdivvsvmssm
geeqicavkevgggk

Timeline for d3hksa2:

• d3hksa2 first appeared in SCOPe 2.03
  
• d3hksa2 appears in SCOPe 2.05
  
• d3hksa2 appears in SCOPe 2.07
  
• d3hksa2 appears in the current release, SCOPe 2.08