Lineage for d3hkfa1 (3hkf A:241-344)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752782Domain d3hkfa1: 3hkf A:241-344 [211108]
    automated match to d1igyb3
    complexed with cl, mg

Details for d3hkfa1

PDB Entry: 3hkf (more details), 2.5 Å

PDB Description: murine unglycosylated igg fc fragment
PDB Compounds: (A:) Igh protein

SCOPe Domain Sequences for d3hkfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hkfa1 b.1.1.2 (A:241-344) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfn
stfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkg

SCOPe Domain Coordinates for d3hkfa1:

Click to download the PDB-style file with coordinates for d3hkfa1.
(The format of our PDB-style files is described here.)

Timeline for d3hkfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hkfa2